Total Roofing Hub
Total Roofing HubRoofing And Siding BlogsRoofing Near MeSiding Repair Near Me
AlabamaArizonaCaliforniaFloridaGeorgiaLouisianaNorth CarolinaSouth CarolinaTennesseeTexas
AlabamaArizonaCaliforniaFloridaGeorgiaLouisianaNorth CarolinaSouth CarolinaTennesseeTexas

Total Roofing HubSiding Repair Near MeArizonaYavapai CountyChino ValleySiding Repair in State Highway 89Heritage Roofing
Heritage Roofing ico

Heritage Roofing
- 1620 AZ-89 #3, Chino Valley, AZ 86323

Roofing contractor ★4.0

1620 AZ-89 #3, Chino Valley, AZ 86323, USA

4.0
We recently hired Heritage Roofing for a roofing job, and I couldn’t be happier with the results. From start to finish, their team was professional, efficient, and courteous. They communicated clearly throughout the process, showed up on time, and completed the job within the promised timeframe.The quality of the workmanship is outstanding. It’s clear they take pride in their work and value their customers. I highly recommend them to anyone in need of roofing services. Great job, and thank you Alejandro for all your help. - Diego Galvan
Heritage Roofing Overview Intro Roof shingle Detail Photos Location Reviews

Heritage Roofing Introduce

Expert Roofing Services with Heritage Roofing in Arizona

In the beautiful and often unpredictable climate of Arizona, a sturdy and well-maintained roof is your first line of defense against the elements. From the blistering summer sun to the occasional heavy rains and strong winds, your roof takes a constant beating. When it’s time for a repair, a full replacement, or a new installation, finding a roofing contractor you can trust is essential. For residents of Chino Valley and the surrounding communities, Heritage Roofing has built a stellar reputation as a company that delivers on its promises. Known for their professionalism, efficiency, and exceptional quality of work, Heritage Roofing has become a preferred choice for homeowners and businesses alike who demand the best for their properties.

The team at Heritage Roofing understands that a roofing project can be a significant investment and a source of stress for property owners. That’s why they are dedicated to making the entire process as seamless and transparent as possible. From the initial consultation to the final inspection, they prioritize clear communication, ensuring that you are informed and comfortable every step of the way. Their crews are not just skilled; they are courteous, respectful, and committed to leaving your property cleaner than they found it. This focus on customer experience, combined with their outstanding craftsmanship, is what sets them apart. This article will delve into what makes Heritage Roofing a top-tier choice for locals, covering their convenient location, the range of services they offer, and the unique highlights that define their service.

Location and Accessibility

Conveniently located in the heart of Chino Valley, Heritage Roofing is perfectly positioned to serve the diverse roofing needs of Northern Arizona. Their office is situated at 1620 AZ-89 #3, Chino Valley, AZ 86323, USA. This strategic location along State Route 89 makes their services easily accessible to residents and businesses throughout Chino Valley, Prescott, Prescott Valley, and other nearby towns. Being a local company means they have an intimate understanding of the architectural styles, common roofing materials, and specific weather-related challenges of the region. This local knowledge allows them to provide tailored solutions that are not only effective but also long-lasting. Whether your property is nestled in a quiet Chino Valley neighborhood or located on the outskirts of Prescott, the Heritage Roofing team can quickly and efficiently get to your location, providing timely service and expert craftsmanship right to your doorstep. Their local presence reinforces their commitment to the community they serve, making them a true neighbor you can rely on.

Services Offered

Heritage Roofing provides a comprehensive suite of roofing services, catering to both residential and commercial clients. Their team of experienced professionals is equipped to handle everything from minor repairs to complete roof overhauls, ensuring your property remains safe and protected. Their services are designed to meet the unique needs of Arizona properties and include:

  • Residential Roofing: Heritage Roofing specializes in residential roof installations, replacements, and repairs. They work with a variety of materials, including asphalt shingles, tiles, and metal, to provide a solution that fits your home's style and budget. They are experts at ensuring your home’s roof is a durable shield against the harsh sun and monsoon seasons.

  • Commercial Roofing: Business owners can also rely on Heritage Roofing for their commercial roofing needs. The team has the expertise to handle the unique challenges of commercial properties, from flat roofs to low-slope systems, ensuring a watertight and professional finish that protects your investment.

  • Roof Repairs: Whether it's a leak, storm damage, or wear and tear, Heritage Roofing provides prompt and effective repair services. They conduct thorough inspections to diagnose the problem accurately and provide a durable solution that extends the life of your current roof, saving you from a costly replacement when it's not necessary.

  • New Roof Installations: For new constructions or major renovations, their team provides professional installation services. They guide clients through the process of choosing the right materials and ensure the installation is performed with the highest level of craftsmanship and adherence to all building codes.

  • Roof Inspections and Maintenance: Regular inspections and maintenance are key to preventing major roofing problems. Heritage Roofing offers professional inspection services to identify potential issues before they become serious, helping homeowners and businesses protect their properties proactively.

Features and Highlights

The positive feedback from satisfied customers consistently points to several key features that make Heritage Roofing an outstanding choice. These highlights are a direct reflection of the company's commitment to excellence and customer satisfaction.

  • Professionalism and Courtesy: Customers repeatedly praise the team's professional and courteous demeanor. From the first phone call to the final cleanup, the staff and crew are respectful of your time and property. They show up on time and work diligently, creating a stress-free experience for the homeowner.

  • Exceptional Workmanship: The quality of the work performed by Heritage Roofing is consistently described as "outstanding." The crews, including crew lead Manuel, take immense pride in their work, ensuring every shingle, tile, or panel is installed with precision and care. This attention to detail results in a beautiful and long-lasting finished product that homeowners can be proud of.

  • Clear and Consistent Communication: A common point of praise is the company's excellent communication. Team members like Alejandro are highlighted for their helpfulness and for keeping clients informed throughout the entire process. This transparency builds trust and ensures there are no surprises, from the initial estimate to the project's completion.

  • Efficiency and Timeliness: The Heritage Roofing team is known for its efficiency. They complete jobs within the promised timeframe, a crucial factor for homeowners who don't want to deal with a prolonged construction project. Their ability to deliver a quality result quickly and on schedule is a significant advantage.

  • Commitment to a Clean Job Site: One of the most appreciated aspects of their service is their dedication to cleanliness. Customers note that the team leaves the job site "better than when they arrived," ensuring that there are no nails, debris, or other hazards left behind. This respect for the homeowner's property is a testament to their professionalism.

Contact Information

If you're in need of professional and reliable roofing services, Heritage Roofing is ready to help. The team is always available to discuss your project, provide a detailed estimate, and answer any questions you may have. You can reach them at the following:

  • Address: 1620 AZ-89 #3, Chino Valley, AZ 86323, USA

  • Phone: (928) 910-2765

You can also ask for Alejandro, Justin, or Lem to get started on a project that's sure to be a job well done.

Conclusion: Why Heritage Roofing is the Ideal Choice for Arizona Locals

For residents and business owners in Chino Valley and the broader Arizona region, selecting the right roofing contractor is a crucial decision. Heritage Roofing stands out as a company that embodies the values that matter most to local customers: reliability, integrity, and exceptional quality. Their local presence in Chino Valley means they are more than just a service provider; they are a community partner. The consistent praise for their professionalism, clear communication, and outstanding workmanship, as seen in the reviews, is a powerful testament to their dedication. They not only provide a high-quality product but also an enjoyable and stress-free customer experience. When you choose Heritage Roofing, you are investing in a durable, expertly installed roof and a team that will treat you and your property with the utmost respect. For a roofing job that is done right the first time, on time, and with a smile, Heritage Roofing is the perfect choice for anyone in the Arizona community.

Heritage Roofing Roof shingle

  • Roofing Contractor

  • Attic venting
  • Roof damage repair
  • Roof inspection
  • Roof installation
  • Roof repair

    Trust a professional with the most important investment of your home (your roof), which keeps everything beneath it dry and secure. We will promptly come and inspect your roof to determine if your roof is able to be repaired or if you need a new roof altogether.

  • Roof repair for storm & wind damage

    After the past storm, did you notice a leak that you had to pull out your buckets for? If you're looking for a quick response from roofer in the Prescott, AZ area, Heritage Roofing is at your service! No matter how much the damage is, we have a solution custom-fit for you and your budget.

  • Skylight installation
  • Affordable Roofing
  • Air Conditioning
  • Air Conditioning Unit
  • All Flat Roofs
  • Architectural Shingles
  • Asphalt Roofing
  • Asphalt Shingle Roof
  • Asphalt Shingle Roofs
  • Asphalt Shingles
  • Brand New Roof
  • Brand New Roofing
  • Ceramic Roofing
  • Certified Roofing
  • Claim Assistance
  • Commercial And Residential Roofing
  • Commercial Building
  • Commercial Property
  • Commercial Roof Repair
  • Commercial Roof Repaired
  • Commercial Roofer
  • Commercial Roofers
  • Commercial Roofing
  • Commercial Roofing Projects
  • Commercial Roofing Services

    Prescott roofing takes the brunt of various weather elements that can be destructive to a commercial building’s roof, causing vulnerability to leaks, holes and weak points. Knowing that your commercial property’s integrity is priority, starting from the top to protect what’s within is detrimental to any property owner. Heritage Roofing are the roofing contractors of Prescott Valley AZ, serving Prescott and surrounding areas. We are the go-to professionals who have been roofing Prescott AZ for over 20 years providing courteous, friendly, fast, efficient and top-class quality service. Your ultimate satisfaction is our goal. The maintenance, care and durability of your commercial building’s roof is our prime domain and our responsibility, providing you with peace of mind and quality assurance. We are a locally-owned family business who are true to our word and here to serve you and your building’s needs.

  • Commercial Roofing Systems
  • Completely New Roof
  • Composition Roofing
  • Comprehensive Inspection
  • Custom Home Roofs
  • Damaged Roof
  • Designer Shingles
  • Dimensional Shingle
  • Elite Roofing
  • Entire Roof
  • Expert Repairs
  • Extensive Roofing
  • Fire Protection
  • Fire Safety
  • Flat Roofing
  • Flat Roofs
  • Flat Torch Down Roofs
  • Free Consultations
  • Free Inspections And Estimates
  • Free Insurance Claim Assistance
  • GAF Master Elite
  • Gaf Shingles
  • Grand Sequoia
  • Guaranteed Roofing
  • Hail And Wind Damage
  • Hail And Wind Repair
  • Hail Damage
  • Heating And Cooling
  • Heavier Roofing
  • Heavy Roof
  • Heritage Cost Estimates

    Knowing the cost of a new or repair roofing project is always wise. Knowing the materials, the labor and time involved gives both customer and Heritage Roofing contractors an idea of timeframe and expectations. That’s why we offer free roofing cost estimates. We list our Heritage roofing shingles price, torch down roofing material prices, Heritage roof tiles cost, Timberline Ultra HD Roofing shingles cost, and our other material offering prices plus labor depending on the size of the roof. The project will be laid out with options and recommendations that best suit each customer. Prescott roofing is a unique expertise and with over 20 years in roofing Prescott AZ, Heritage Roofing are your go-to pros to provide accurate, detailed and quality roofing cost estimates for the most efficient and top-of-the-line service.

  • Heritage Roofing
  • Heritage Roofing Installation

    Heritage Roofing is knowledgeable in a variety of roofing materials with the proper installation requirements for each one. Working in Prescott roofing for over 20 years, we know the climate in the Prescott area, the lifespan, durability and upkeep of each type of roof and offer the best recommendations that are right for you and your property. We go through all the options and with fast, efficient, and thorough service we provide a superior installation job to meet your expectations. Top-rated roofing contractors Prescott Valley AZ, we take pride in doing a job well done with quality materials including Timberline 50 year shingles in the GAF Timberline Ultra HD Colors and natural shadow shingles. We install slate, tile, metal, asphalt, TPO, and Torchdown roofing materials. Your home, your style, your budget, we are happy to work on your property’s specific needs to suit you.

  • Heritage Roofing Repair

    Trust Heritage Roofing contractors with your roofing repair needs. We repair all types and sizes of roofs, and will guarantee our ability, speed, and workmanship, all while providing proficient, friendly service. Whatever your repair needs, we are sure to meet or exceed your expectations. We have industry leading warranties and provide superior service to safeguard long term satisfaction with your roof. We know there are quality roofing companies in Prescott AZ, Heritage Roofing is one of the few that are a Certified GAF Contractor who are able to offer 50-year manufacturer warranties. We are proud to serve Prescott and surrounding areas. We are licensed, insured and bonded to ensure quality work in an efficient manner – We rise above the rest for roofing Prescott AZ.

  • High Quality Roofing
  • Holes In The Roof
  • Home Roof Repairs
  • Home Services
  • Inspection And Repair
  • Installation And Repair
  • Insurance Claim Assistance
  • Insurance Claims
  • Leak Repair
  • Leaking Roof Repair

    Your roof protects all your belongings. It is the first line of defense against the various elements of the Central Highlands’ climate. There are many causes for a damaged roof that makes it vulnerable to leaks. Every drop of water on a poorly maintained roof is the potential for a water-damaged computer or ruined family photo. You have everything to lose by waiting. Heritage Roofing is here to make sure that your home stays free of water damage from a leaking or poorly maintained roof. Call your trusted Heritage Roofing contractors to inspect your roof for any vulnerabilities to prevent a leak. Regular maintenance of your Prescott roofing is highly recommended and can save you money in the long run when issues are prevented from the get-go. Top-rated Roofing Contractors Prescott Valley AZ are your professionals to call in the event of a leaky roof needing repair with fast, reliable and affordable service.

  • Leaky Roof
  • Local Roofing
  • Local Roofing Company
  • Luxury Shingle
  • Maintenance Checks
  • Membrane Roofing
  • Membrane Roofs
  • Metal Roofers
  • Metal Roofing
  • Metal Roofing Systems
  • Modified Bitumen Roofing
  • New Build Roofing
  • New Construction Home Roofing
  • New Construction Projects
  • New Construction Roof
  • New Homes
  • New Roof Put
  • New Shingles
  • Office Building
  • Old Roof
  • Pitched Roofs
  • Presidential Roofing
  • Professional Roofer
  • Re-Roofing
  • Regular Roof Maintenance
  • Removal And Replacement
  • Repair Your Roof
  • Replace Metal Roofing
  • Replacing Your Roof
  • Residential And Commercial Roofing
  • Residential Re-roof
  • Residential Roofers
  • Residential Roofing Contractor
  • Residential Roofing Project
  • Residential Roofing Roof
  • Residential Roofing Services

    Heritage Roofing are the experts at residential roofing. We have the knowledge of an array of roofing materials that are ideal for Prescott roofing projects. There are so many types of shingles and roofing materials that it can be really hard to pick what type would be best for your application. At Heritage Roofing we want to help you make an informed decision when determining the type of roofing material that you should use for your home. With each type of roofing material comes their own benefit. Asphalt, slate, tile, Torchdown, metal roofing and more. We help you asses the benefits and what to be weary of for each type. We are also GAF certified roofing contractors Prescott Valley AZ, one of the only companies in Prescott AZ to offer the Timberline 50 year shingles warranty. We are a locally-owned family business with over 20 years’ experience. Our goal is to provide top-notch quality roofing services to exceed your expectations at an affordable price.

  • Residential Roofing Specialized
  • Roof Coating
  • Roof Create
  • Roof Inspections
  • Roof Leak Repair
  • Roof Maintenance
  • Roof Patching
  • Roof Problems
  • Roof Repair Warranties
  • Roof Replacement
  • Roof Warranties
  • RoofMax Alternative
  • Roofing Company
  • Roofing Consultation
  • Roofing Consultations
  • Roofing Design
  • Roofing Help
  • Roofing Installation Services
  • Roofing Materials
  • Roofing New Construction
  • Roofing Projects
  • Roofing Removal
  • Roofing Removal And Replacement
  • Roofing Repair And Insurance Claims
  • Roofing Requiring
  • Roofing Shingles
  • Roofing Solutions
  • Roofing Systems
  • Roofs Save
  • Secure Roof
  • Service For Your Home
  • Service Vehicle
  • Shake Roofing
  • Shingle Colors
  • Shingle Coverage
  • Shingle Roofing
  • Shingles Certainteed
  • Silicone Coating
  • Silicone Roof Coating
  • Silicone Roof Coatings
  • Skylight Replacement
  • Slate And Tile Shingles
  • Slate Roof
  • Slate Shingles
  • Standing Seam Metal
  • Standing Seam Metal Roof
  • Steep Roof
  • Steep Slope Roofs
  • Storm Damage Roof Repair
  • Thermoplastic Polyolefin Roofing
  • Tile Roof Contractor
  • Tile Roofing
  • Tile Roofing Construction
  • Tile Shingles
  • Timberline Roofing Shingles
  • Torch Down Roofing
  • Tpo Roofing
  • Traditional Tile Roofing
  • Types Of Roofing
  • Water Damage
  • Wind Repair
  • Yearly Maintenance
  • Your Roofing Repairs

Heritage Roofing Details

  • Service options

  • Onsite services
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot

Heritage Roofing Photos

Heritage Roofing Picture 1Heritage Roofing Picture 2Heritage Roofing Picture 3Heritage Roofing Picture 4Heritage Roofing Picture 5Heritage Roofing Picture 6Heritage Roofing Picture 7Heritage Roofing Picture 8Heritage Roofing Picture 9Heritage Roofing Picture 10

Heritage Roofing Location

Heritage Roofing

1620 AZ-89 #3, Chino Valley, AZ 86323, USA

Heritage Roofing Reviews

An average rating of ★4.9 from 483 user reviews.

crewquestionsestimateinspectionhailefficientskylightswarrantyproject managerdamage

★ 5★ 4★ 3★ 2★ 1

More Siding Repair Near Me

  • Pinon Painting, LLCPinon Painting, LLC4.0 (302 reviews)

    1032 Fair St, Prescott, AZ 86305, USA

  • Prescott Roofing ProsPrescott Roofing Pros0.0 (0 reviews)

    560 Lodge Trail Cir, Prescott, AZ 86303, USA

  • Golden RoofingGolden Roofing5.0 (20 reviews)

    629 Miller Valley Rd, Prescott, AZ 86301, USA

  • Prescott Builders of AZ, LLCPrescott Builders of AZ, LLC4.0 (6 reviews)

    305 N Summit Ave B, Prescott, AZ 86301, USA

  • Alexander Roofing LLCAlexander Roofing LLC5.0 (17 reviews)

    960 Peace Ln, Prescott, AZ 86305, USA

  • Granite Basin RoofingGranite Basin Roofing4.0 (20 reviews)

    1225 Gail Gardner Way, Prescott, AZ 86305, USA

  • Arizona Building Supply - A Division of US LBM - Prescott Home Center (fka Foxworth-Galbraith Home Improvement Center)Arizona Building Supply - A Division of US LBM - Prescott Home Center (fka Foxworth-Galbraith Home Improvement Center)4.0 (56 reviews)

    430 6th St #12, Prescott, AZ 86301, USA

  • Yavapai RoofingYavapai Roofing4.0 (63 reviews)

    555 E Z St, Prescott, AZ 86301, USA

  • Central Basin RoofingCentral Basin Roofing4.0 (24 reviews)

    331 N Arizona Ave, Prescott, AZ 86301, USA

  • Listol PaintingListol Painting4.0 (21 reviews)

    196 Sheffield Dr, Prescott, AZ 86303, USA

  • Willbuilt Seamless Gutters by Willbuilt ConstructionWillbuilt Seamless Gutters by Willbuilt Construction4.0 (121 reviews)

    2170 E Lillian Ln, Prescott, AZ 86301, USA

  • M&M landscaping and maintenance servicesM&M landscaping and maintenance services4.0 (9 reviews)

    1617 Heritage Park Rd, Prescott, AZ 86301, USA

  • Categories

    Top Visited Sites

    Trending Roofing And Siding Blogs Posts